SYNTHETIC PEPTIDE INFORMATION


Peptide name STIG12
Gene ID Medtr7g074340
Family Name Stigma1/GRI (STIG/GRI)
Known SSP Family ID STIG-GRI
Peptide sequence RSVCCRNRCVDVTSDADNCGFCGIRCPFIGNWQCCNRFCANI
Peptide Length 42
Modifications -
Molecular weight (avg) 4721.40
Pl 7.590
Gravy 0.0140000
Company PEPSCAN
Purity % 81.5
Amount (mg) 10.0
Aliquot (mg) 1
Aliquot to 1 mM (uL) 172.6
Solubility Prediction Poor water solubility
Reference -


ROOT TRAITS


Root Phenotype Summary no effect
Root Phenotype Summary Images: Peptide treated x Control - untreated (no peptide)
Ca-Spike Assay positive



PRIMARY ROOT TRAITS

* Significant phenotypes observed
Mt: Medicago truncatula; At: Arabidopsis thaliana; Pv: Panicum virgatum

Mt Primary root length (cm) 91%
At Primary root length (cm) -
Pv Primary root length (cm) -
Mt Lateral root density (no/cm) 101%
At Lateral root density (no/cm) -
Pv Lateral root density (no/cm) -
Mt Mean diameter (cm) 98%
At Mean diameter (cm) -
Pv Mean diameter (cm) -
Mt Surface area (cm2) 91%
At Surface area (cm2) -
Pv Surface area (cm2) -
Mt Volume (cm3) 94%
At Volume (cm3) -
Pv Volume (cm3) -
Mt Straightness (vector length/total length) 98%
At Straightness (vector length/total length) -
Pv Straightness (vector length/total length) -

LATERAL ROOT TRAITS

* Significant phenotypes observed
Mt: Medicago truncatula; At: Arabidopsis thaliana; Pv: Panicum virgatum

Mt Total number of lateral roots 101%
Mt Total lateral root length (cm) 100%
At Total lateral root length (cm) -
Mt Number of secondary lateral roots 93%
At Number of secondary lateral roots -
Pv Number of secondary lateral roots -
Mt Total length of secondary lateral roots 95%
At Total length of secondary lateral roots -
Pv Total length of secondary lateral roots -
Mt Mean length of secondary lateral roots 104%
At Mean length of secondary lateral roots -
Pv Mean length of secondary lateral roots -
Mt Mean diameter of secondary lateral roots (cm) 104%
At Mean diameter of secondary lateral roots (cm) -
Pv Mean diameter of secondary lateral roots (cm) -
Mt Mean diameter of all lateral roots (cm) 103%
Mt Surface area of secondary lateral roots (cm2) 99%
At Surface area of secondary lateral roots (cm2) -
Pv Surface area of secondary lateral roots (cm2) -
Mt Volume of secondary lateral roots (cm3) 104%
At Volume of secondary lateral roots (cm3) -
Pv Volume of secondary lateral roots (cm3) -
Mt Insertion angle of secondary lateral roots -
At Insertion angle of secondary lateral roots -
Pv Insertion angle of secondary lateral roots -

TOTAL ROOT TRAITS

* Significant phenotypes observed
Mt: Medicago truncatula; At: Arabidopsis thaliana; Pv: Panicum virgatum

Mt Total root length (cm) 97%
At Total root length (cm) -
Pv Total root length (cm) -
Mt Surface area of total root system (cm2) 98%
At Surface area of total root system (cm2) -
Pv Surface area of total root system (cm2) -
Mt Total root system volume (cm3) 99%
At Total root system volume (cm3) -
Pv Total root system volume (cm3) -

NODULE TRAITS

* Significant phenotypes observed
Mt: Medicago truncatula

Nodule Phenotype Summary no statistical difference
Mt Nodule number 92%
Mt Nodule density 93%