SYNTHETIC PEPTIDE INFORMATION
| Peptide name | RALF12 |
|---|---|
| Gene ID | Medtr7g113080 |
| Family Name | Rapid Alkalinization Factor (RALF) |
| Known SSP Family ID | RALF |
| Peptide sequence | ATTKYISYGALQRNTVPCSRRGASYYNCRPGAQANPYSRGCSAITRCRG |
| Peptide Length | 49 |
| Modifications | - |
| Molecular weight (avg) | 5348.10 |
| Pl | 10.240 |
| Gravy | -0.7200000 |
| Company | PEPSCAN |
| Purity % | 73.5 |
| Amount (mg) | 10.0 |
| Aliquot (mg) | 1 |
| Aliquot to 1 mM (uL) | 137.4 |
| Solubility Prediction | Good water solubility |
| Reference | - |
ROOT TRAITS
| Root Phenotype Summary | slightly higher density and diameter or lateral roots |
|---|---|
| Root Phenotype Summary Images: Peptide treated x Control - untreated (no peptide) |
|
| Ca-Spike Assay | positive |
PRIMARY ROOT TRAITS
* Significant phenotypes observed
Mt: Medicago truncatula; At: Arabidopsis thaliana; Pv: Panicum virgatum
| Mt Primary root length (cm) | 98% |
|---|---|
| At Primary root length (cm) | - |
| Pv Primary root length (cm) | - |
| Mt Lateral root density (no/cm) | 110% |
|---|---|
| At Lateral root density (no/cm) | - |
| Pv Lateral root density (no/cm) | - |
| Mt Mean diameter (cm) | 107% |
|---|---|
| At Mean diameter (cm) | - |
| Pv Mean diameter (cm) | - |
| Mt Surface area (cm2) | 103% |
|---|---|
| At Surface area (cm2) | - |
| Pv Surface area (cm2) | - |
| Mt Volume (cm3) | 105% |
|---|---|
| At Volume (cm3) | - |
| Pv Volume (cm3) | - |
| Mt Straightness (vector length/total length) | 100% |
|---|---|
| At Straightness (vector length/total length) | - |
| Pv Straightness (vector length/total length) | - |
LATERAL ROOT TRAITS
* Significant phenotypes observed
Mt: Medicago truncatula; At: Arabidopsis thaliana; Pv: Panicum virgatum
| Mt Total number of lateral roots | 117% |
|---|
| Mt Total lateral root length (cm) | 107% |
|---|---|
| At Total lateral root length (cm) | - |
| Mt Number of secondary lateral roots | 108% |
|---|---|
| At Number of secondary lateral roots | - |
| Pv Number of secondary lateral roots | - |
| Mt Total length of secondary lateral roots | 103% |
|---|---|
| At Total length of secondary lateral roots | - |
| Pv Total length of secondary lateral roots | - |
| Mt Mean length of secondary lateral roots | 94% |
|---|---|
| At Mean length of secondary lateral roots | - |
| Pv Mean length of secondary lateral roots | - |
| Mt Mean diameter of secondary lateral roots (cm) | 114% |
|---|---|
| At Mean diameter of secondary lateral roots (cm) | - |
| Pv Mean diameter of secondary lateral roots (cm) | - |
| Mt Mean diameter of all lateral roots (cm) | 113% |
|---|
| Mt Surface area of secondary lateral roots (cm2) | 119% |
|---|---|
| At Surface area of secondary lateral roots (cm2) | - |
| Pv Surface area of secondary lateral roots (cm2) | - |
| Mt Volume of secondary lateral roots (cm3) | 135% |
|---|---|
| At Volume of secondary lateral roots (cm3) | - |
| Pv Volume of secondary lateral roots (cm3) | - |
| Mt Insertion angle of secondary lateral roots | - |
|---|---|
| At Insertion angle of secondary lateral roots | - |
| Pv Insertion angle of secondary lateral roots | - |
TOTAL ROOT TRAITS
* Significant phenotypes observed
Mt: Medicago truncatula; At: Arabidopsis thaliana; Pv: Panicum virgatum
| Mt Total root length (cm) | 104% |
|---|---|
| At Total root length (cm) | - |
| Pv Total root length (cm) | - |
| Mt Surface area of total root system (cm2) | 113% |
|---|---|
| At Surface area of total root system (cm2) | - |
| Pv Surface area of total root system (cm2) | - |
| Mt Total root system volume (cm3) | 117% |
|---|---|
| At Total root system volume (cm3) | - |
| Pv Total root system volume (cm3) | - |
NODULE TRAITS
* Significant phenotypes observed
Mt: Medicago truncatula
| Nodule Phenotype Summary | no statistical difference |
|---|---|
| Mt Nodule number | 54% |
| Mt Nodule density | 54% |