Peptide name | MEG2 |
---|---|
Gene ID | MT4Noble_004794 |
Family Name | Maternally Expressed Gene (MEG) |
Known SSP Family ID | MEG |
Peptide sequence | LCLASPCCYVFTCNLPNKPFGFCSFIPKTCNCFGCHH |
Peptide Length | 37 |
Modifications | - |
Molecular weight (avg) | 4117.00 |
Pl | 7.090 |
Gravy | 0.5300000 |
Company | PEPSCAN |
Purity % | 84.8 |
Amount (mg) | 10.0 |
Aliquot (mg) | 1 |
Aliquot to 1 mM (uL) | 206.0 |
Solubility Prediction | Poor water solubility |
Reference | - |
Root Phenotype Summary | shorter lateral root length |
---|---|
Root Phenotype Summary Images: Peptide treated x Control - untreated (no peptide) |
![]() ![]() |
Ca-Spike Assay | negative |
Mt Primary root length (cm) | 97% |
---|---|
At Primary root length (cm) | - |
Pv Primary root length (cm) | - |
Mt Lateral root density (no/cm) | 114% |
---|---|
At Lateral root density (no/cm) | - |
Pv Lateral root density (no/cm) | - |
Mt Mean diameter (cm) | 104% |
---|---|
At Mean diameter (cm) | - |
Pv Mean diameter (cm) | - |
Mt Surface area (cm2) | 99% |
---|---|
At Surface area (cm2) | - |
Pv Surface area (cm2) | - |
Mt Volume (cm3) | 100% |
---|---|
At Volume (cm3) | - |
Pv Volume (cm3) | - |
Mt Straightness (vector length/total length) | 101% |
---|---|
At Straightness (vector length/total length) | - |
Pv Straightness (vector length/total length) | - |
Mt Total number of lateral roots | 112% |
---|
Mt Total lateral root length (cm) | 86% |
---|---|
At Total lateral root length (cm) | - |
Mt Number of secondary lateral roots | 110% |
---|---|
At Number of secondary lateral roots | - |
Pv Number of secondary lateral roots | - |
Mt Total length of secondary lateral roots | 85% |
---|---|
At Total length of secondary lateral roots | - |
Pv Total length of secondary lateral roots | - |
Mt Mean length of secondary lateral roots | 76%* |
---|---|
At Mean length of secondary lateral roots | - |
Pv Mean length of secondary lateral roots | - |
Mt Mean diameter of secondary lateral roots (cm) | 101% |
---|---|
At Mean diameter of secondary lateral roots (cm) | - |
Pv Mean diameter of secondary lateral roots (cm) | - |
Mt Mean diameter of all lateral roots (cm) | 101% |
---|
Mt Surface area of secondary lateral roots (cm2) | 87% |
---|---|
At Surface area of secondary lateral roots (cm2) | - |
Pv Surface area of secondary lateral roots (cm2) | - |
Mt Volume of secondary lateral roots (cm3) | 89% |
---|---|
At Volume of secondary lateral roots (cm3) | - |
Pv Volume of secondary lateral roots (cm3) | - |
Mt Insertion angle of secondary lateral roots | - |
---|---|
At Insertion angle of secondary lateral roots | - |
Pv Insertion angle of secondary lateral roots | - |
Mt Total root length (cm) | 89% |
---|---|
At Total root length (cm) | - |
Pv Total root length (cm) | - |
Mt Surface area of total root system (cm2) | 93% |
---|---|
At Surface area of total root system (cm2) | - |
Pv Surface area of total root system (cm2) | - |
Mt Total root system volume (cm3) | 96% |
---|---|
At Total root system volume (cm3) | - |
Pv Total root system volume (cm3) | - |
Nodule Phenotype Summary | fewer nodules, lower nodule density |
---|---|
Mt Nodule number | 32%* |
Mt Nodule density | 34%* |