SYNTHETIC PEPTIDE INFORMATION
| Peptide name | Legin 9/10/33 |
|---|---|
| Gene ID | Medtr3g067540 Medtr3g067555 Medtr3g067550 |
| Family Name | Leginsulin (Legin) |
| Known SSP Family ID | Legin |
| Peptide sequence | DKCGAYCPYPRLYCSGDCDCEPFIASLPPRLNFKCVTPHS |
| Peptide Length | 40 |
| Modifications | - |
| Molecular weight (avg) | 4468.20 |
| Pl | 6.670 |
| Gravy | -0.2700000 |
| Company | PEPSCAN |
| Purity % | 97.9 |
| Amount (mg) | 10.0 |
| Aliquot (mg) | 1 |
| Aliquot to 1 mM (uL) | 219.1 |
| Solubility Prediction | Good water solubility |
| Reference | - |
ROOT TRAITS
| Root Phenotype Summary | Longer primary and lateral roots and somewhat higher lateral root density |
|---|---|
| Root Phenotype Summary Images: Peptide treated x Control - untreated (no peptide) |
|
| Ca-Spike Assay | positive |
PRIMARY ROOT TRAITS
* Significant phenotypes observed
Mt: Medicago truncatula; At: Arabidopsis thaliana; Pv: Panicum virgatum
| Mt Primary root length (cm) | 125%* |
|---|---|
| At Primary root length (cm) | - |
| Pv Primary root length (cm) | - |
| Mt Lateral root density (no/cm) | 111% |
|---|---|
| At Lateral root density (no/cm) | - |
| Pv Lateral root density (no/cm) | - |
| Mt Mean diameter (cm) | 102% |
|---|---|
| At Mean diameter (cm) | - |
| Pv Mean diameter (cm) | - |
| Mt Surface area (cm2) | 126%* |
|---|---|
| At Surface area (cm2) | - |
| Pv Surface area (cm2) | - |
| Mt Volume (cm3) | 122%* |
|---|---|
| At Volume (cm3) | - |
| Pv Volume (cm3) | - |
| Mt Straightness (vector length/total length) | 100% |
|---|---|
| At Straightness (vector length/total length) | - |
| Pv Straightness (vector length/total length) | - |
LATERAL ROOT TRAITS
* Significant phenotypes observed
Mt: Medicago truncatula; At: Arabidopsis thaliana; Pv: Panicum virgatum
| Mt Total number of lateral roots | 126% |
|---|
| Mt Total lateral root length (cm) | 139%* |
|---|---|
| At Total lateral root length (cm) | - |
| Mt Number of secondary lateral roots | 138%* |
|---|---|
| At Number of secondary lateral roots | - |
| Pv Number of secondary lateral roots | - |
| Mt Total length of secondary lateral roots | 146%* |
|---|---|
| At Total length of secondary lateral roots | - |
| Pv Total length of secondary lateral roots | - |
| Mt Mean length of secondary lateral roots | 101% |
|---|---|
| At Mean length of secondary lateral roots | - |
| Pv Mean length of secondary lateral roots | - |
| Mt Mean diameter of secondary lateral roots (cm) | 104% |
|---|---|
| At Mean diameter of secondary lateral roots (cm) | - |
| Pv Mean diameter of secondary lateral roots (cm) | - |
| Mt Mean diameter of all lateral roots (cm) | 105% |
|---|
| Mt Surface area of secondary lateral roots (cm2) | 152%* |
|---|---|
| At Surface area of secondary lateral roots (cm2) | - |
| Pv Surface area of secondary lateral roots (cm2) | - |
| Mt Volume of secondary lateral roots (cm3) | 156%* |
|---|---|
| At Volume of secondary lateral roots (cm3) | - |
| Pv Volume of secondary lateral roots (cm3) | - |
| Mt Insertion angle of secondary lateral roots | - |
|---|---|
| At Insertion angle of secondary lateral roots | - |
| Pv Insertion angle of secondary lateral roots | - |
TOTAL ROOT TRAITS
* Significant phenotypes observed
Mt: Medicago truncatula; At: Arabidopsis thaliana; Pv: Panicum virgatum
| Mt Total root length (cm) | 135%* |
|---|---|
| At Total root length (cm) | - |
| Pv Total root length (cm) | - |
| Mt Surface area of total root system (cm2) | 137%* |
|---|---|
| At Surface area of total root system (cm2) | - |
| Pv Surface area of total root system (cm2) | - |
| Mt Total root system volume (cm3) | 134%* |
|---|---|
| At Total root system volume (cm3) | - |
| Pv Total root system volume (cm3) | - |
NODULE TRAITS
* Significant phenotypes observed
Mt: Medicago truncatula
| Nodule Phenotype Summary | fewer nodules, lower nodule density |
|---|---|
| Mt Nodule number | 15%* |
| Mt Nodule density | 15%* |