Peptide name | Legin5 |
---|---|
Gene ID | Medtr3g067437 |
Family Name | Leginsulin (Legin) |
Known SSP Family ID | Legin |
Peptide sequence | ESCESRGCIFYINDSCPSGCVCDPIDPVTWAGVCVSYSS |
Peptide Length | 39 |
Modifications | - |
Molecular weight (avg) | 4150.60 |
Pl | 3.530 |
Gravy | 0.2200000 |
Company | PEPSCAN |
Purity % | 48.1 |
Amount (mg) | 4.3 |
Aliquot (mg) | 1 |
Aliquot to 1 mM (uL) | 115.9 |
Solubility Prediction | Poor water solubility |
Reference | - |
Root Phenotype Summary | - |
---|---|
Root Phenotype Summary Images: Peptide treated x Control - untreated (no peptide) | Not Available |
Ca-Spike Assay | - |
Mt Primary root length (cm) | - |
---|---|
At Primary root length (cm) | - |
Pv Primary root length (cm) | - |
Mt Lateral root density (no/cm) | - |
---|---|
At Lateral root density (no/cm) | - |
Pv Lateral root density (no/cm) | - |
Mt Mean diameter (cm) | - |
---|---|
At Mean diameter (cm) | - |
Pv Mean diameter (cm) | - |
Mt Surface area (cm2) | - |
---|---|
At Surface area (cm2) | - |
Pv Surface area (cm2) | - |
Mt Volume (cm3) | - |
---|---|
At Volume (cm3) | - |
Pv Volume (cm3) | - |
Mt Straightness (vector length/total length) | - |
---|---|
At Straightness (vector length/total length) | - |
Pv Straightness (vector length/total length) | - |
Mt Total number of lateral roots | - |
---|
Mt Total lateral root length (cm) | - |
---|---|
At Total lateral root length (cm) | - |
Mt Number of secondary lateral roots | - |
---|---|
At Number of secondary lateral roots | - |
Pv Number of secondary lateral roots | - |
Mt Total length of secondary lateral roots | - |
---|---|
At Total length of secondary lateral roots | - |
Pv Total length of secondary lateral roots | - |
Mt Mean length of secondary lateral roots | - |
---|---|
At Mean length of secondary lateral roots | - |
Pv Mean length of secondary lateral roots | - |
Mt Mean diameter of secondary lateral roots (cm) | - |
---|---|
At Mean diameter of secondary lateral roots (cm) | - |
Pv Mean diameter of secondary lateral roots (cm) | - |
Mt Mean diameter of all lateral roots (cm) | - |
---|
Mt Surface area of secondary lateral roots (cm2) | - |
---|---|
At Surface area of secondary lateral roots (cm2) | - |
Pv Surface area of secondary lateral roots (cm2) | - |
Mt Volume of secondary lateral roots (cm3) | - |
---|---|
At Volume of secondary lateral roots (cm3) | - |
Pv Volume of secondary lateral roots (cm3) | - |
Mt Insertion angle of secondary lateral roots | - |
---|---|
At Insertion angle of secondary lateral roots | - |
Pv Insertion angle of secondary lateral roots | - |
Mt Total root length (cm) | - |
---|---|
At Total root length (cm) | - |
Pv Total root length (cm) | - |
Mt Surface area of total root system (cm2) | - |
---|---|
At Surface area of total root system (cm2) | - |
Pv Surface area of total root system (cm2) | - |
Mt Total root system volume (cm3) | - |
---|---|
At Total root system volume (cm3) | - |
Pv Total root system volume (cm3) | - |
Nodule Phenotype Summary | - |
---|---|
Mt Nodule number | - |
Mt Nodule density | - |