| Peptide name | Family36_3 |
|---|---|
| Gene ID | MT35v5_AC233577_32 |
| Family Name | Family_36 |
| Putative SSP Family ID | Family_36 |
| Peptide sequence | PIAFDSRSGVSSLSLAMALEYECGAGSSCIPEEEISVW |
| Peptide Length | 38 |
| Modifications | - |
| Molecular weight (avg) | 3992.50 |
| Pl | 3.360 |
| Gravy | 0.3100000 |
| Company | PEPSCAN |
| Purity % | 70.8 |
| Amount (mg) | 1.6 |
| Aliquot (mg) | none |
| Aliquot to 1 mM (uL) | 283.7 |
| Solubility Prediction | Poor water solubility |
| Reference | - |
| Root Phenotype Summary | - |
|---|---|
| Root Phenotype Summary Images: Peptide treated x Control - untreated (no peptide) | Not Available |
| Ca-Spike Assay | - |
| Mt Primary root length (cm) | - |
|---|---|
| At Primary root length (cm) | - |
| Pv Primary root length (cm) | - |
| Mt Lateral root density (no/cm) | - |
|---|---|
| At Lateral root density (no/cm) | - |
| Pv Lateral root density (no/cm) | - |
| Mt Mean diameter (cm) | - |
|---|---|
| At Mean diameter (cm) | - |
| Pv Mean diameter (cm) | - |
| Mt Surface area (cm2) | - |
|---|---|
| At Surface area (cm2) | - |
| Pv Surface area (cm2) | - |
| Mt Volume (cm3) | - |
|---|---|
| At Volume (cm3) | - |
| Pv Volume (cm3) | - |
| Mt Straightness (vector length/total length) | - |
|---|---|
| At Straightness (vector length/total length) | - |
| Pv Straightness (vector length/total length) | - |
| Mt Total number of lateral roots | - |
|---|
| Mt Total lateral root length (cm) | - |
|---|---|
| At Total lateral root length (cm) | - |
| Mt Number of secondary lateral roots | - |
|---|---|
| At Number of secondary lateral roots | - |
| Pv Number of secondary lateral roots | - |
| Mt Total length of secondary lateral roots | - |
|---|---|
| At Total length of secondary lateral roots | - |
| Pv Total length of secondary lateral roots | - |
| Mt Mean length of secondary lateral roots | - |
|---|---|
| At Mean length of secondary lateral roots | - |
| Pv Mean length of secondary lateral roots | - |
| Mt Mean diameter of secondary lateral roots (cm) | - |
|---|---|
| At Mean diameter of secondary lateral roots (cm) | - |
| Pv Mean diameter of secondary lateral roots (cm) | - |
| Mt Mean diameter of all lateral roots (cm) | - |
|---|
| Mt Surface area of secondary lateral roots (cm2) | - |
|---|---|
| At Surface area of secondary lateral roots (cm2) | - |
| Pv Surface area of secondary lateral roots (cm2) | - |
| Mt Volume of secondary lateral roots (cm3) | - |
|---|---|
| At Volume of secondary lateral roots (cm3) | - |
| Pv Volume of secondary lateral roots (cm3) | - |
| Mt Insertion angle of secondary lateral roots | - |
|---|---|
| At Insertion angle of secondary lateral roots | - |
| Pv Insertion angle of secondary lateral roots | - |
| Mt Total root length (cm) | - |
|---|---|
| At Total root length (cm) | - |
| Pv Total root length (cm) | - |
| Mt Surface area of total root system (cm2) | - |
|---|---|
| At Surface area of total root system (cm2) | - |
| Pv Surface area of total root system (cm2) | - |
| Mt Total root system volume (cm3) | - |
|---|---|
| At Total root system volume (cm3) | - |
| Pv Total root system volume (cm3) | - |
| Nodule Phenotype Summary | - |
|---|---|
| Mt Nodule number | - |
| Mt Nodule density | - |