| Peptide name | Family36_2 |
|---|---|
| Gene ID | MT4Noble_003781 |
| Family Name | Family_36 |
| Putative SSP Family ID | Family_36 |
| Peptide sequence | PINLIRDRELVSSCNLVWLEWWFATKSDFGG |
| Peptide Length | 31 |
| Modifications | - |
| Molecular weight (avg) | 3653.10 |
| Pl | 4.440 |
| Gravy | 0.0130000 |
| Company | PEPSCAN |
| Purity % | 70.3 |
| Amount (mg) | 10.0 |
| Aliquot (mg) | 1 |
| Aliquot to 1 mM (uL) | 192.4 |
| Solubility Prediction | Poor water solubility |
| Reference | - |
| Root Phenotype Summary | shorter primary and lateral root length and more lateral roots |
|---|---|
| Root Phenotype Summary Images: Peptide treated x Control - untreated (no peptide) |
|
| Ca-Spike Assay | negative |
| Mt Primary root length (cm) | 90% |
|---|---|
| At Primary root length (cm) | 51%* |
| Pv Primary root length (cm) | 87%* |
| Mt Lateral root density (no/cm) | 134%* |
|---|---|
| At Lateral root density (no/cm) | 161%* |
| Pv Lateral root density (no/cm) | 92% |
| Mt Mean diameter (cm) | 105% |
|---|---|
| At Mean diameter (cm) | 86%* |
| Pv Mean diameter (cm) | 95% |
| Mt Surface area (cm2) | 95% |
|---|---|
| At Surface area (cm2) | 43%* |
| Pv Surface area (cm2) | 84%* |
| Mt Volume (cm3) | 100% |
|---|---|
| At Volume (cm3) | 37%* |
| Pv Volume (cm3) | 81%* |
| Mt Straightness (vector length/total length) | 101% |
|---|---|
| At Straightness (vector length/total length) | 100% |
| Pv Straightness (vector length/total length) | 99% |
| Mt Total number of lateral roots | 127% |
|---|
| Mt Total lateral root length (cm) | 99% |
|---|---|
| At Total lateral root length (cm) | 81% |
| Mt Number of secondary lateral roots | 119% |
|---|---|
| At Number of secondary lateral roots | 75%* |
| Pv Number of secondary lateral roots | 82% |
| Mt Total length of secondary lateral roots | 96% |
|---|---|
| At Total length of secondary lateral roots | 81% |
| Pv Total length of secondary lateral roots | 91% |
| Mt Mean length of secondary lateral roots | 79%* |
|---|---|
| At Mean length of secondary lateral roots | 117% |
| Pv Mean length of secondary lateral roots | 115% |
| Mt Mean diameter of secondary lateral roots (cm) | 101% |
|---|---|
| At Mean diameter of secondary lateral roots (cm) | 94% |
| Pv Mean diameter of secondary lateral roots (cm) | 96% |
| Mt Mean diameter of all lateral roots (cm) | 101% |
|---|
| Mt Surface area of secondary lateral roots (cm2) | 99% |
|---|---|
| At Surface area of secondary lateral roots (cm2) | 78% |
| Pv Surface area of secondary lateral roots (cm2) | 94% |
| Mt Volume of secondary lateral roots (cm3) | 101% |
|---|---|
| At Volume of secondary lateral roots (cm3) | 74% |
| Pv Volume of secondary lateral roots (cm3) | 78% |
| Mt Insertion angle of secondary lateral roots | - |
|---|---|
| At Insertion angle of secondary lateral roots | 93% |
| Pv Insertion angle of secondary lateral roots | 94% |
| Mt Total root length (cm) | 96% |
|---|---|
| At Total root length (cm) | 69%* |
| Pv Total root length (cm) | 88% |
| Mt Surface area of total root system (cm2) | 98% |
|---|---|
| At Surface area of total root system (cm2) | 61%* |
| Pv Surface area of total root system (cm2) | 84%* |
| Mt Total root system volume (cm3) | 101% |
|---|---|
| At Total root system volume (cm3) | 54%* |
| Pv Total root system volume (cm3) | 80%* |
| Nodule Phenotype Summary | fewer nodules, lower nodule density |
|---|---|
| Mt Nodule number | 10%* |
| Mt Nodule density | 12%* |