Peptide name | EPFL3 |
---|---|
Gene ID | Medtr2g039920 |
Family Name | Epidermal Patterning Factor-Like (EPFL) |
Known SSP Family ID | EPFL |
Peptide sequence | IGSTPPRCEHKCGGCIPCNPTQKPTNKHLIGVQYANYEPEGWKCMCGT |
Peptide Length | 48 |
Modifications | - |
Molecular weight (avg) | 5249.10 |
Pl | 7.396 |
Gravy | -0.7000000 |
Company | PEPSCAN |
Purity % | 93.6 |
Amount (mg) | 10.0 |
Aliquot (mg) | 1 |
Aliquot to 1 mM (uL) | 178.3 |
Solubility Prediction | Good water solubility |
Reference | - |
Root Phenotype Summary | slightly longer and larger diameter lateral roots |
---|---|
Root Phenotype Summary Images: Peptide treated x Control - untreated (no peptide) | |
Ca-Spike Assay | negative |
Mt Primary root length (cm) | 90% |
---|---|
At Primary root length (cm) | - |
Pv Primary root length (cm) | - |
Mt Lateral root density (no/cm) | 106% |
---|---|
At Lateral root density (no/cm) | - |
Pv Lateral root density (no/cm) | - |
Mt Mean diameter (cm) | 108% |
---|---|
At Mean diameter (cm) | - |
Pv Mean diameter (cm) | - |
Mt Surface area (cm2) | 95% |
---|---|
At Surface area (cm2) | - |
Pv Surface area (cm2) | - |
Mt Volume (cm3) | 99% |
---|---|
At Volume (cm3) | - |
Pv Volume (cm3) | - |
Mt Straightness (vector length/total length) | 101% |
---|---|
At Straightness (vector length/total length) | - |
Pv Straightness (vector length/total length) | - |
Mt Total number of lateral roots | 93% |
---|
Mt Total lateral root length (cm) | 102% |
---|---|
At Total lateral root length (cm) | - |
Mt Number of secondary lateral roots | 97% |
---|---|
At Number of secondary lateral roots | - |
Pv Number of secondary lateral roots | - |
Mt Total length of secondary lateral roots | 106% |
---|---|
At Total length of secondary lateral roots | - |
Pv Total length of secondary lateral roots | - |
Mt Mean length of secondary lateral roots | 116% |
---|---|
At Mean length of secondary lateral roots | - |
Pv Mean length of secondary lateral roots | - |
Mt Mean diameter of secondary lateral roots (cm) | 110% |
---|---|
At Mean diameter of secondary lateral roots (cm) | - |
Pv Mean diameter of secondary lateral roots (cm) | - |
Mt Mean diameter of all lateral roots (cm) | 110% |
---|
Mt Surface area of secondary lateral roots (cm2) | 115% |
---|---|
At Surface area of secondary lateral roots (cm2) | - |
Pv Surface area of secondary lateral roots (cm2) | - |
Mt Volume of secondary lateral roots (cm3) | 122% |
---|---|
At Volume of secondary lateral roots (cm3) | - |
Pv Volume of secondary lateral roots (cm3) | - |
Mt Insertion angle of secondary lateral roots | - |
---|---|
At Insertion angle of secondary lateral roots | - |
Pv Insertion angle of secondary lateral roots | - |
Mt Total root length (cm) | 99% |
---|---|
At Total root length (cm) | - |
Pv Total root length (cm) | - |
Mt Surface area of total root system (cm2) | 106% |
---|---|
At Surface area of total root system (cm2) | - |
Pv Surface area of total root system (cm2) | - |
Mt Total root system volume (cm3) | 109% |
---|---|
At Total root system volume (cm3) | - |
Pv Total root system volume (cm3) | - |
Nodule Phenotype Summary | no statistical difference |
---|---|
Mt Nodule number | 96% |
Mt Nodule density | 96% |