Peptide name | EPFL17 |
---|---|
Gene ID | Medtr7g028475 |
Family Name | Epidermal Patterning Factor-Like (EPFL) |
Known SSP Family ID | EPFL |
Peptide sequence | IGSHPPNCKGKCGTCTPCTLTREQLPPSDVTDPAPERWMCKCGN |
Peptide Length | 44 |
Modifications | - |
Molecular weight (avg) | 4730.50 |
Pl | 7.460 |
Gravy | -0.7300000 |
Company | PEPSCAN |
Purity % | 94.5 |
Amount (mg) | 10.0 |
Aliquot (mg) | 1 |
Aliquot to 1 mM (uL) | 266.2 |
Solubility Prediction | Good water solubility |
Reference | - |
Root Phenotype Summary | shorter primary root, smaller lateral root diameter |
---|---|
Root Phenotype Summary Images: Peptide treated x Control - untreated (no peptide) | Not Available |
Ca-Spike Assay | - |
Mt Primary root length (cm) | 85%* |
---|---|
At Primary root length (cm) | - |
Pv Primary root length (cm) | - |
Mt Lateral root density (no/cm) | 103% |
---|---|
At Lateral root density (no/cm) | - |
Pv Lateral root density (no/cm) | - |
Mt Mean diameter (cm) | 95% |
---|---|
At Mean diameter (cm) | - |
Pv Mean diameter (cm) | - |
Mt Surface area (cm2) | 84%* |
---|---|
At Surface area (cm2) | - |
Pv Surface area (cm2) | - |
Mt Volume (cm3) | 84%* |
---|---|
At Volume (cm3) | - |
Pv Volume (cm3) | - |
Mt Straightness (vector length/total length) | 99% |
---|---|
At Straightness (vector length/total length) | - |
Pv Straightness (vector length/total length) | - |
Mt Total number of lateral roots | 78% |
---|
Mt Total lateral root length (cm) | 83% |
---|---|
At Total lateral root length (cm) | - |
Mt Number of secondary lateral roots | 87% |
---|---|
At Number of secondary lateral roots | - |
Pv Number of secondary lateral roots | - |
Mt Total length of secondary lateral roots | 87% |
---|---|
At Total length of secondary lateral roots | - |
Pv Total length of secondary lateral roots | - |
Mt Mean length of secondary lateral roots | 99% |
---|---|
At Mean length of secondary lateral roots | - |
Pv Mean length of secondary lateral roots | - |
Mt Mean diameter of secondary lateral roots (cm) | 89%* |
---|---|
At Mean diameter of secondary lateral roots (cm) | - |
Pv Mean diameter of secondary lateral roots (cm) | - |
Mt Mean diameter of all lateral roots (cm) | 89%* |
---|
Mt Surface area of secondary lateral roots (cm2) | 78% |
---|---|
At Surface area of secondary lateral roots (cm2) | - |
Pv Surface area of secondary lateral roots (cm2) | - |
Mt Volume of secondary lateral roots (cm3) | 73% |
---|---|
At Volume of secondary lateral roots (cm3) | - |
Pv Volume of secondary lateral roots (cm3) | - |
Mt Insertion angle of secondary lateral roots | - |
---|---|
At Insertion angle of secondary lateral roots | - |
Pv Insertion angle of secondary lateral roots | - |
Mt Total root length (cm) | 84% |
---|---|
At Total root length (cm) | - |
Pv Total root length (cm) | - |
Mt Surface area of total root system (cm2) | 79%* |
---|---|
At Surface area of total root system (cm2) | - |
Pv Surface area of total root system (cm2) | - |
Mt Total root system volume (cm3) | 78%* |
---|---|
At Total root system volume (cm3) | - |
Pv Total root system volume (cm3) | - |
Nodule Phenotype Summary | no statistical difference |
---|---|
Mt Nodule number | 15% |
Mt Nodule density | 14% |